PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00382.1.g00210.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family HSF
Protein Properties Length: 262aa    MW: 28741.5 Da    PI: 5.0392
Description HSF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00382.1.g00210.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HSF_DNA-bind80.52.5e-251169260
                                  HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHT CS
                  HSF_DNA-bind  2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmY 60
                                  Fl+k+y ++ed+ ++++isw+++g++fvv+ ++efa+++Lpk+Fkhsnf+SFvRQLn+Y
  Zmw_sc00382.1.g00210.1.am.mk 11 FLTKTYAMVEDPGTDDTISWNDTGKAFVVWRPDEFARDLLPKHFKHSNFSSFVRQLNTY 69
                                  9********************************************************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.106.5E-285105IPR011991Winged helix-turn-helix DNA-binding domain
SMARTSM004155.2E-297101IPR000232Heat shock factor (HSF)-type, DNA-binding
SuperFamilySSF467857.48E-24969IPR011991Winged helix-turn-helix DNA-binding domain
PfamPF004471.6E-2211105IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000562.1E-141134IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000562.1E-144961IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000562.1E-146274IPR000232Heat shock factor (HSF)-type, DNA-binding
Gene3DG3DSA:1.20.5.1701.8E-4106139No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 262 aa     Download sequence    Send to blast
MASPAAGTPP FLTKTYAMVE DPGTDDTISW NDTGKAFVVW RPDEFARDLL PKHFKHSNFS  60
SFVRQLNTYV SSHPFSSSYT QPFVRLDRDH ELGLCCVQGF KKVVADRWDG AVAELEEENA  120
RLRRENARLT RELARARRLC DGVRRLMSRY DHGGEGEDEA GSDGGRGGGA GPGGKPMLFG  180
VAIGSKRHRG NEEEEEEDDG AEDNGEEEDD DDERPVVRAR ESKKRNDQSD LDVLALSVRA  240
AAAARPGSGA AAGSRDRKSS VS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ldu_A1e-171691178Heat shock factor protein 1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015691545.19e-57PREDICTED: heat stress transcription factor B-2a-like
SwissprotQ7XRX32e-44HFB2A_ORYSJ; Heat stress transcription factor B-2a
TrEMBLB6SLK93e-68B6SLK9_MAIZE; Heat shock factor protein 4
STRINGMLOC_65182.11e-67(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP12137394